PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0042s0570.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HB-other
Protein Properties Length: 506aa    MW: 57197 Da    PI: 8.8101
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0042s0570.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.81.1e-192175357
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                            kRt  t+ q+++Le+++++++yp++e++ eLA+++gLte+q++ WF+ rR k+k+
  SapurV1A.0042s0570.4.p 21 KRTVKTPAQVDALENFYNEHKYPTEEMKSELADQIGLTEKQISSWFCHRRLKDKR 75
                            8****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-21275IPR009057Homeodomain-like
PROSITE profilePS5007117.071676IPR001356Homeobox domain
SMARTSM003891.1E-191880IPR001356Homeobox domain
SuperFamilySSF466891.07E-171880IPR009057Homeodomain-like
CDDcd000862.72E-182175No hitNo description
PfamPF000463.4E-172175IPR001356Homeobox domain
PROSITE patternPS0002705174IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MEESSEVHSV ENRFSPDKNF KRTVKTPAQV DALENFYNEH KYPTEEMKSE LADQIGLTEK  60
QISSWFCHRR LKDKRLRDEG CTNGRQDRSS GIIQDRGSGL RQDSCGSTKQ GDYRNLDPRE  120
VESQRPYGQN FHTADLTYDR TSRYTGHDSS IDNISSGSSS SLQDKFVSQR EDPYDAENSK  180
YLAQNEAAMP LIPKGADSFG YKPSGYLKVK GEIENAAITA VKMQLGRHYK EDGPPLGVEF  240
QPLPPGAFAS PSRDPANGPI YVGDLARMCS PDVSGVRKQS SLGTRYEVYG TKMSSHDSYT  300
EGANCNPEHS DSHDKKSHHH LEQKPTYNGS NSNAGGNSAM DMPDDLAGET SAYVNKRHYR  360
MSSKHGFEGR RLDSLSTHHG PSGRRNSEKT EAWLYDCNND NPKIVQRNNY MSKHPHLMRG  420
FGKSLDTEER APRTITEKED KLYGEMKRMK AFHDPVRVRR HPTDESTVAK RFRVDFPQQE  480
YVAKASFSER HRRTNLTKGS KFRKG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002313994.20.0hypothetical protein POPTR_0009s07600g
TrEMBLB9HNF30.0B9HNF3_POPTR; Uncharacterized protein
STRINGPOPTR_0009s07600.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.16e-86HB-other family protein